Active human RANTES full length protein

Name Active human RANTES full length protein
Supplier Abcam
Catalog ab192136
Category Protein
Prices $192.00
Sizes 20 µg
Applications SDS-PAGE FA
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to chemoattract Human blood monocytes using a concentration range of 1-10 ng/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P13501
Gene CCL5
Residue 24 to 91
Sequence SPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVC ANPEKKWVREYINSLEMS
Supplier Page Shop