Human PI 3 Kinase regulatory subunit 4 protein fragment
| Name | Human PI 3 Kinase regulatory subunit 4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab153319 |
| Category | Protein |
| Applications | ELISA WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q99570 |
| Gene | PIK3R4 |
| Residue | 1259 to 1358 |
| Sequence | AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQ KVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK |
| Supplier Page | Shop |
Product images
ab153319 on a 12.5% SDS-PAGE stained with Coomassie Blue.