Human PMP2 full length protein
| Name | Human PMP2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab115501 |
| Category | Protein |
| Applications | WB ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P02689 |
| Gene | PMP2 |
| Residue | 2 to 132 |
| Sequence | MKHHHHHHASNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVI ISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSL NQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Supplier Page | Shop |
Product images
14% SDS-PAGE showing ab115501 Lane 1: M.W. marker – 14, 21, 31, 45, 66, 97 kDa Lane 2: reduced and boiled sample, 5µg/lane. Lane 3: non-reduced and non-boiled sample, 5µg/lane.