| Name | Active human SDF1 alpha full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab192132 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 10 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Determined by its ability to chemoattract Human U937 expressing CXCR4 Determined by calcium flux with Human U937 cells. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P48061 |
| Gene | CXCL12 |
| Residue | 24 to 88 |
| Sequence | VSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCID PKLKWIQEYLEKALN |
| Supplier Page | Shop |