Active human SDF1 beta full length protein

Name Active human SDF1 beta full length protein
Supplier Abcam
Catalog ab192137
Category Protein
Prices $192.00
Sizes 10 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to chemoattract Human peripheral T cells activated with PHA and IL-2 using a concentration range of 5.0-40 ng/mL.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P48061
Gene CXCL12
Residue 24 to 93
Sequence VSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCID PKLKWIQEYLEKALNKRFKM
Supplier Page Shop