Human ProDynorphin protein fragment
| Name | Human ProDynorphin protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114453 |
| Category | Protein |
| Applications | WB SDS-PAGE ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P01213 |
| Gene | PDYN |
| Residue | 205 to 254 |
| Sequence | KRYGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVTRSQEDPNAYSGELFDA |
| Supplier Page | Shop |
Product images
ab114453 analysed on a 12.5% SDS-PAGE stained with Coomassie Blue.