Human Protein phosphatase 1 inhibitor 3C protein fragment
| Name | Human Protein phosphatase 1 inhibitor 3C protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab117033 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | Q9UQK1 |
| Gene | PPP1R3C |
| Residue | 221 to 317 |
| Sequence | DLPPVIPTEQKIEFCISYHANGQVFWDNNDGQNYRIVHVQWKPDGVQTQM APQDCAFHQTSPKTELESTIFGSPRLASGLFPEWQSWGRMENLASYR |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE stained with Coomassie Blue showing ab117033 at approximately 36.30 kDa.