Human Protein phosphatase 1 inhibitor subunit 2 protein fragment
| Name | Human Protein phosphatase 1 inhibitor subunit 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab114836 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P41236 |
| Gene | PPP1R2 |
| Residue | 1 to 100 |
| Sequence | MAASTASHRPIKGILKNKTSTTSSMVASAEQPRGNVDEELSKKSQKWDEM NILATYHPADKDYGLMKIDEPSTPYHSMMGDDEDACSDTEATEAMAPDIL |
| Supplier Page | Shop |
Product images
ab114836 analysed on a 12.5% SDS-PAGE gel stained with Coomassie Blue.