Human Psoriasin full length protein
| Name | Human Psoriasin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab105577 |
| Category | Protein |
| Applications | WB SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 90 % by SDS-PAGE. ab105577 was purified using conventional chromatography. |
| SwissProt/Accession | P31151 |
| Gene | S100A7 |
| Residue | 1 to 101 |
| Sequence | MGSSHHHHHHSSGLVPRGSH MSNTQAERSIIGMIDMFHKYTRRDDKIDKP SLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEFLSLLG DIATDYHKQSHGAAPCSGGSQ |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab105577 (3ug)
Anti-Psoriasin antibody ( ab83534 ) at 1 µg/ml + Human Psoriasin full length protein (ab105577) at 0.01 µg Secondary Goat Anti-Rabbit IgG H&L (HRP) preadsorbed ( ab97080 ) at 1/5000 dilution developed using the ECL technique Performed under reducing conditions. Exposure time : 1 minute