Active human SOD2 full length protein

Name Active human SOD2 full length protein
Supplier Abcam
Catalog ab93946
Category Protein
Prices $200.00, $706.00
Sizes 100 µg, 500 µg
Applications SDS-PAGE MS
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity > 95 % by SDS-PAGE. ab93946 was purified using conventional chromatography techniques.
Bioactivity Specific activity is > 1,200 units/mg, in which one unit will inhibit the rate of reduction of cytochrome c by 50% in a coupled system, using xanthine and Xanthine oxidase at pH 7.8 at 25°C in a 1.5 ml reaction volume. Activity Assay Prepare a 1.5 ml reaction mix into a suitable container and pre-chill on ice before use: The final concentrations are 50mM potassium phosphate, 0.1mM ethylendiaminetetraacetic acid, 0.01mM cytochrome C, 0.05mM xanthine, 0.005 units xanthine oxidase. Equilibrate to 25°C and monitor at A550nm until the value is constant using a spectrophotometer. Add 50 ul of recombinant SOD protein in various concentrations (0.5 ug, 1 ug) in assay buffer. Mix by inversion and record the increase at A550nm for 5 minutes.
SwissProt/Accession P04179
Gene SOD2
Sequence MGSSHHHHHHSSGLVPRGSHMKHSLPDLPYDYGALEPHINAQIMQLHHSK HHAAYVNNLNVTEEKYQEALAKGDVTAQIALQPALKFNGGGHINHSIFWT NLSPNGGGEPKGELLEAIKRDFGSFDKFKEKLTAASVGVQGSGWGWLGFN KERGHLQIAACPNQDPLQGTTGLIPLLGIDVWEHAYYLQYKNVRPDYLKA IWNVINWENVTERYMACKK
Supplier Page Shop

Product images