Recombinant Human GCP-2 (CXCL6)

Name Recombinant Human GCP-2 (CXCL6)
Supplier RayBiotech
Catalog 213-10123-2
Category Protein
Prices $190.00
Sizes 2 µg
Species Reactivities Human
Nature Recombinant
Source Escherichia coli (E.coli)
Purity 98%
Endotoxin Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Gene CXCL6
Sequence VLTELRCTCLRVTLRVNPKTIGKLQVFPAGPQCSKVEVVASLKNGKQVCL DPEAPFLKKVIQKILDSGNKKN
Description GCP-2 is a connective tissue derived CXC chemokine that can signal through the CXCR1 and CXCR2 receptors
Supplier Page Shop