Recombinant Human Neuritin

Name Recombinant Human Neuritin
Supplier RayBiotech
Catalog 213-10320-2
Category Protein
Prices $190.00
Sizes 2 µg
Species Reactivities Human
Nature Recombinant
Source Escherichia coli (E.coli)
Purity 98%
Endotoxin Endotoxin level is <0.1 ng/μg of protein (<1EU/μg).
Gene NRN1
Sequence AGKCDAVFKGFSDCLLKLGDSMANYPQGLDDKTNIKTVCTYWEDFHSCTV TALTDCQEGAKDMWDKLRKESKNLNIQGSLFELCGSGN
Description Neuritin is a neurotrophic factor, which is expressed in response to induction of neuronal activity by NGF, BDNF, NT3, and other neural stimulators
Supplier Page Shop