| Name | Recombinant Human NP-1 |
|---|---|
| Supplier | RayBiotech |
| Catalog | 213-10328-2 |
| Category | Protein |
| Prices | $190.00 |
| Sizes | 2 µg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia coli (E.coli) |
| Purity | 98% |
| Endotoxin | Endotoxin level is <0.1 ng/μg of protein (<1EU/μg). |
| Gene | NPTX1 |
| Sequence | ACYCRIPACIAGERRYGYCIYQGRLWAFCC |
| Description | Defensins (α and β) are cationic peptides with a broad spectrum of antimicrobial activity that comprise an important arm of the innate immune system |
| Supplier Page | Shop |