| Name | Recombinant Rat Resistin |
|---|---|
| Supplier | RayBiotech |
| Catalog | 213-10375-2 |
| Category | Protein |
| Prices | $190.00 |
| Sizes | 2 µg |
| Species Reactivities | Rat |
| Nature | Recombinant |
| Source | Escherichia coli (E.coli) |
| Purity | 97% |
| Endotoxin | Endotoxin level is <0.1 ng/μg of protein (<1EU/μg). |
| Gene | Retn |
| Sequence | PSMSLCPMDEAISKKINQDFSSLLPAAMKNTVLHCWSVSSRGRLASCPEG TTVTSCSCGSGCGSWDVREDTMCHCQCGSIDWTAARCCTLRVGS |
| Description | Resistin belongs to a family of tissue-specific cytokines termed FIZZ (found in inflammatory zones) and RELM. The three known members of this family; Resistin, RELM-α and RELM-β share a highly conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X 11 -C-X 8 -C-X-C-X 3 -C-X 10 -C-X-C-X-C-X 9 -C-C. Resistin is an adipose-derived cytokine (adipokine) whose physiological function and molecular targets are largely unknown |
| Supplier Page | Shop |