| Name | Active human Sumo 1 (mutated K16 R + K17 R) full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191003 |
| Category | Protein |
| Prices | $408.00 |
| Sizes | 250 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Sumo1 chains do not readily form in vitro . However, the role of Sumo1 in poly SUMO chain formation is an area of intense research. Utilizing ab191003 will ensure that K16 and K17 linked chains will not be formed. Reaction conditions will need to be optimized for each specific application. Typical in vitro concentrations for conjugate formation is 10-50 μM depending on conditions. |
| SwissProt/Accession | P63165 |
| Gene | SUMO1 |
| Residue | 1 to 101 |
| Sequence | MSDQEAKPSTEDLGDRREGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKES YCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST V |
| Supplier Page | Shop |