Active human Sumo 1 full length protein
| Name | Active human Sumo 1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab157010 |
| Category | Protein |
| Prices | $192.00 |
| Sizes | 25 µg |
| Applications | FA HPLC |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Bioactivity | ab157010 activity was confirmed by its inhibition of SENP1 deSUMOylation of SUMO1-AMC. Typical assay set-up: substrate concentration: 0.1-2.0µM. Enzyme concentration: 0.1-1µM. Inhibitor concentration: 0.1-2.0µM. Release of AMC fluorescence by DUB enzymes can be monitored spectrophotometrically using 380nm excitation and 460nm emission wavelengths. Concentration determination: Sumo 1 aldehyde sample concentration determined by measurement of absorbance at 280nm by spectrophotometry, and comparison with a Sumo 1 calibration curve produced by serial dilution (2.0-0.125mg/mL). |
| SwissProt/Accession | P63165 |
| Gene | SUMO1 |
| Residue | 1 to 101 |
| Sequence | MSDQEAKPSTEDLGDKKEGEYIKLKVIGQDSSEIHFKVKMTTHLKKLKES YCQRQGVPMNSLRFLFEGQRIADNHTPKELGMEEEDVIEVYQEQTGGHST V |
| Supplier Page | Shop |
Product images
SENP Assay (typical) using ab157010. 0.5µM SENP1 Catalytic Domain (His); 2µM SUMO1-AMC; 2µM SUMO-1 aldehyde (ab157010 pink line); 20mM TRIS-Cl, pH8.0, 20mM NaCl, 5mM DTT.