| Name | Active human Sumo 2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab190034 |
| Category | Protein |
| Prices | $342.00 |
| Sizes | 25 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Mono- and di-Sumo 2 have been removed from the chain mixture. |
| Bioactivity | Poly-SUMO-2 chains can be used to investigate mechanisms of chain recognition, binding and hydrolysis by SUMO-specific isopeptidases (SENPs), SUMO-specific E3 ligases or other proteins that contain Sumo 2 binding domains. Typical concentrations will depend on specific assay conditions and method of detection. |
| SwissProt/Accession | P61956 |
| Gene | SUMO2 |
| Residue | 1 to 95 |
| Sequence | MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCER QGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY |
| Supplier Page | Shop |