Human Relaxin 3 receptor 1 protein fragment
| Name | Human Relaxin 3 receptor 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab162494 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9NSD7 |
| Gene | RXFP3 |
| Residue | 1 to 80 |
| Sequence | MQMADAATIATMNKAAGGDKLAELFSLVPDLLEAANTSGNASLQLPDLWW ELGLELPDGAPPGHPPGSGGAESADTEARV |
| Supplier Page | Shop |
Product images
ab162494 on a 12.5% SDS-PAGE stained with Coomassie Blue.