Recombinant Human Tissue Factor Pathway Inhibitor 2

• Supplier: RayBiotech
• Catalog: 228-11796-3
• Category: Protein
• Prices: $648.00
• Sizes: 3 µg
• Species Reactivities: Human
• Nature: Recombinant
• Source: Nicotiana benthamiana
• Purity: Greater than 97.0% as determined by SDS-PAGE.
• Gene: TFPI2
• Sequence: HHHHHHGAAQEPTGNNAEICLLPLDYGPCKALLLRYYYDRY TQSCRQFLYGGCEGNANNFYTWEACDDACWRIEKVPKV.
• Description: TFPI2 Human Recombinant produced in plants is a single polypeptide chain containing 79 amino acids and having a total molecular mass of 9.3kDa