Active human TARC full length protein

Name Active human TARC full length protein
Supplier Abcam
Catalog ab191725
Category Protein
Prices $192.00
Sizes 20 µg
Applications FA SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity Determined by its ability to chemoattract Human T cells using a concentration range of 2-40 ng/ml.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession Q92583
Gene CCL17
Residue 24 to 94
Sequence ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAIC SDPNNKRVKNAVKYLQSLERS
Supplier Page Shop