Active human Tetranectin full length protein
| Name | Active human Tetranectin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191970 |
| Category | Protein |
| Prices | $515.00 |
| Sizes | 100 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | Measured by its binding ability in a functional ELISA. Immobilized recombinant human HGF at 5 µg/ml (100 μL/well), the concentration of ab191970 that produces 50% of the optimal binding response is found to be approximately 1 - 10 µg/ml. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P05452 |
| Gene | CLEC3B |
| Residue | 22 to 202 |
| Sequence | EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVC LKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYL RQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTE NCAVLSGAANGKWFDKRCRDQLPYICQFGIV |
| Supplier Page | Shop |
Product images
The purity of ab191970 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 22 kDa in SDS-PAGE due to glycosylation.