Active human TGF beta 1 protein fragment
| Name | Active human TGF beta 1 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab155613 |
| Category | Protein |
| Prices | $352.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Purity | >95% by SDS-PAGE . Lyophilized from 0.22µm filtered solution |
| Bioactivity | The bio-activity was determined by its ability to inhibit IL-4 induced HT-2 cell proliferation. The ED 50 <0.05 ng/ml, corresponding to a specific activity of >2X10 7 unit/mg. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | P01137 |
| Gene | TGFB1 |
| Residue | 279 to 390 |
| Sequence | ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of ab155613 stained overnight with Coomassie Blue. Lane 1: ab155613 reduced. Lane 2: ab155613 non-reduced.