Active human TGF beta 2 full length protein
| Name | Active human TGF beta 2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab129037 |
| Category | Protein |
| Prices | $528.00 |
| Sizes | 5 µg |
| Applications | WB FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Nicotiana benthamiana |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >95% by SDS-PAGE . ab128037 is purified by sequential chromatography (FPLC). This product contains no animal–derived components or impurities. |
| Bioactivity | The biological activity of TGF beta 2 is measured in culture by its ability to inhibit the mink lung epithelial (Mv1Lu) cells proliferation. ED 50 = 40ng/ml. |
| Endotoxin | < 0.040 Eu/µg |
| SwissProt/Accession | P61812 |
| Gene | TGFB2 |
| Residue | 303 to 414 |
| Sequence | HHHHHH ALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFC AGACPYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGK TPKIEQLSNMIVKSCKCS |
| Supplier Page | Shop |
Product images
TGF beta 2 Activity Assay.
SDS-PAGE analysis of ab129037. Samples were loaded in 15% SDS-polyacrylamide gel and stained with Coomassie blue. MWM: Molecular weight marker (kDa); lane 1-2 contain 0.3µg of ab129037. (Under reducing conditions,~ 13kDa monomer and ~ 26kDa homodimers)
All lanes : Anti-TGF beta 2 Lane 1 : Active human TGF beta 2 full length protein (ab129037) Lane 2 : Active human TGF beta 2 full length protein (ab129037) Lysates/proteins at 0.2 µg per lane. Performed under reducing conditions.