Human S100 alpha 6 full length protein
| Name | Human S100 alpha 6 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab167733 |
| Category | Protein |
| Applications | SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . ab167733 was lyophilized from 0.22 µm filtered solution. |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P06703 |
| Gene | S100A6 |
| Residue | 1 to 90 |
| Sequence | MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQD AEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG |
| Supplier Page | Shop |
Product images
SDS-PAGE analysis of reduced ab167733 staining overnight with Coomassie Blue.