Active human TNFSF9 protein fragment
| Name | Active human TNFSF9 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab168048 |
| Category | Protein |
| Prices | $302.00 |
| Sizes | 10 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | DDDDK tag N-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | ab168048 binds to Human CD137 (4-1BB). |
| Endotoxin | < 0.100 Eu/µg |
| SwissProt/Accession | P41273 |
| Gene | TNFSF9 |
| Residue | 49 to 254 |
| Sequence | LACPWAVSGARASPGSAASPRLREGPELSPDDPAGLLDLRQGMFAQLVAQ NVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLE LRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFG FQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGL PSPRSE |
| Supplier Page | Shop |
Product images
Dose-dependent binding of ab168048. Recombinant Human TNFSF9 saturates its receptor at a concentration range of 2-4000ng/ml. Method: Receptor binding assay: a 96-well ELISA plate was coated O/N with 50ng per well of CD137 (Human):Fc (Human) (rec.) (4-1BB:Fc). After a blocking step, the indicated concentrations of ab168048 were added for 1 hour. After extensive washing, an Enhancer was added for 1 hour. Bound ligand was revealed by a rabbit anti-mouse IgG-HRP (1/1000 dilution) incubated for 1 hour. OPD was used as a substrate and absorbance was measured at 490nm in an ELISA reader.