Human SEC14 like protein 2 protein fragment
| Name | Human SEC14 like protein 2 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab161678 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | O76054 |
| Gene | SEC14L2 |
| Residue | 101 to 199 |
| Sequence | DIIGPLDAKGLLFSASKQDLLRTKMRECELLLQECAHQTTKLGRKVETIT IIYDCEGLGLKHLWKPAVEAYGEFLCMFEENYPETLKRLFVVKAPKLFP |
| Supplier Page | Shop |
Product images
ab161678 on a 12.5% SDS-PAGE stained with Coomassie Blue.