| Name | Prokineticin-2, Human, Recombinant |
|---|---|
| Supplier | ARP American Research Products |
| Catalog | 28-10277 |
| Category | Protein |
| Prices | $99.00, $102.00, $199.00 |
| Sizes | 5 µg, 1 mg, 20 µg |
| Species Reactivities | Mouse, Rat |
| Nature | Recombinant |
| Source | E. Coli |
| Purity | 98% |
| Endotoxin | Endotoxin level is <0.1 ng/ug of protein (<1EU/ug). |
| Gene | Prok2 |
| Sequence | AVITGACDKDSQCGGGMCCAVSIWVKSIRICTPMGKLGDSCHPLTRKVPFFGRRMHHTCPCLPGLACLRTSFNRFICLAQK |
| Description | Prokineticin-2 (PK2) is a cysteine-rich secreted protein that is expressed in the testis and in lower levels of the small intestine |
| Supplier Page | Shop |