Human SERF2 full length protein
| Name | Human SERF2 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab171476 |
| Category | Protein |
| Applications | SDS-PAGE MS |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | > 85 % by SDS-PAGE. ab171476 was purified using conventional chromatography techniques |
| SwissProt/Accession | P84101 |
| Gene | SERF2 |
| Residue | 1 to 59 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSMTRGNQRELARQKNMKKQSDSVKGKRR DDGLSAAARKQRDSEIMQQKQKKANEKKEEPK |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of 3µg ab171476.