Human SLC37A4 protein fragment
| Name | Human SLC37A4 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab116881 |
| Category | Protein |
| Applications | ELISA SDS-PAGE WB |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | O43826 |
| Gene | SLC37A4 |
| Residue | 28 to 76 |
| Sequence | RKTFSFVMPSLVEEIPLDKDDLGFITSSQSAAYAISKFVSGVLSDQMSA |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE showing ab116881 at approximately 31.02kDa stained with Coomassie Blue.