Human SOX21 protein fragment
| Name | Human SOX21 protein fragment |
|---|---|
| Supplier | Abcam |
| Catalog | ab161333 |
| Category | Protein |
| Applications | WB ELISA |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| Tag/Conjugation | proprietary tag N-Terminus |
| SwissProt/Accession | Q9Y651 |
| Gene | SOX21 |
| Residue | 224 to 265 |
| Sequence | HSHPSPGNPGYMIPCNCSAWPSPGLQPPLAYILLPGMGKPQL |
| Supplier Page | Shop |
Product images
ab161333 on a 12.5% SDS-PAGE stained with Coomassie Blue.