Human SPINK1 full length protein
| Name | Human SPINK1 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab168878 |
| Category | Protein |
| Applications | MS SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | E. coli |
| Tag/Conjugation | His tag N-Terminus |
| Purity | >90% by SDS-PAGE. ab168878 was purified using conventional chromatography techniques. |
| SwissProt/Accession | P00995 |
| Gene | SPINK1 |
| Residue | 24 to 79 |
| Sequence | MGSSHHHHHHSSGLVPRGSHMGSDSLGREAKCYNELNGCTKIYDPVCGTD GNTYPNECVLCFENRKRQTSILIQKSGPC |
| Supplier Page | Shop |
Product images
15% SDS-PAGE analysis of ab168878 (3µg).