Human SPINK4 full length protein

• Supplier: Abcam
• Catalog: ab152050
• Category: Protein
• Applications: SDS-PAGE HPLC
• Species Reactivities: Human
• Nature: Recombinant
• Source: HEK 293 cells
• Tag/Conjugation: His tag C-Terminus
• Purity: >95% by SDS-PAGE . Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. ab152050 is 0.2 µM filtered.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: O60575
• Gene: SPINK4
• Residue: 27 to 86
• Sequence: GKLPFSRMPICEHMVESPTCSQMSNLVCGTDGLTYTNECQLCLARIKTKQ DIQIMKDGKCVDHHHHHH