Active human VEGFD full length protein
| Name | Active human VEGFD full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab191939 |
| Category | Protein |
| Prices | $515.00 |
| Sizes | 20 µg |
| Applications | FA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | HEK 293 cells |
| Tag/Conjugation | His tag C-Terminus |
| Purity | >95% by SDS-PAGE . |
| Bioactivity | The bioactivity was measured by its ability to stimulate the cell proliferation of human microvascular endothelial cells (HMVECs). The ED 50 for this effect is typically 50-200 ng/mL. |
| Endotoxin | < 1.000 Eu/µg |
| SwissProt/Accession | O43915 |
| Gene | FIGF |
| Residue | 93 to 201 |
| Sequence | FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRC GGCCNE ESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCK CLPTAPRHPYS |
| Supplier Page | Shop |
Product images
The purity of ab191393 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced protein migrates as 18-20 kDa due to different glycosylation.