FGF13 fusion protein

Name FGF13 fusion protein
Supplier Proteintech Group
Catalog Ag23965
Category Protein
Prices $199.00
Sizes 50
Species Reactivities Human
Source E. coli -derived, PGEX-4T
Tag/Conjugation gst
Purity 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Bioactivity Not tested.
Endotoxin Please contact the lab for more information.
Gene FGF13
Sequence LTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST (212-245aa encoded by BC034340 )
Supplier Page Shop

Product images