Human Thymosin beta 10 full length protein
| Name | Human Thymosin beta 10 full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab132133 |
| Category | Protein |
| Applications | WB ELISA SDS-PAGE |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Wheat germ |
| SwissProt/Accession | P63313 |
| Gene | TMSB10 |
| Residue | 1 to 44 |
| Sequence | MADKPDMGEIASFDKAKLKKTETQEKNTLPTKETIEQEKRSEIS |
| Supplier Page | Shop |
Product images
12.5% SDS-PAGE analysis of ab1321333 stained with Coomassie Blue.