POTEH fusion protein
| Name | POTEH fusion protein |
|---|---|
| Supplier | Proteintech Group |
| Catalog | Ag20275 |
| Category | Protein |
| Prices | $199.00 |
| Sizes | 50 μg |
| Species Reactivities | Human |
| Source | E. coli -derived, PGEX-4T |
| Tag/Conjugation | gst |
| Purity | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Bioactivity | Not tested. |
| Endotoxin | Please contact the lab for more information. |
| Gene | POTEH |
| Sequence | MGKWCRHCFAWCRGSGKSNVGTSGDHDDSAMKTLRS (24-59aa encoded by BC148758 ) |
| Supplier Page | Shop |
Product images
