Active mouse beta Defensin 3 full length protein

• Supplier: Abcam
• Catalog: ab191750
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: SDS-PAGE FA
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: The ED 50 was determined by its ability to chemoattract immature Human dendritic cells using a concentration range of 1-50 ng/mL.
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: P81534
• Gene: DEFB103B
• Residue: 23 to 63
• Sequence: KKINNPVSCLRKGGRCWNRCIGNTRQIGSCGVPFLKCCKRK