| Name | Active mouse Betacellulin full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab200293 |
| Category | Protein |
| Prices | $107.00 |
| Sizes | 5 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | > 96 % by SDS-PAGE. |
| Bioactivity | The ED 50 as determined by a cell proliferation assay using murine Balb/c 3T3 cells is less than 0.01 ng/mL, corresponding to a specific activity of > 1.0 x 10 8 IU/mg. |
| SwissProt/Accession | P35070 |
| Gene | BTC |
| Residue | 32 to 111 |
| Sequence | DGNTTRTPETNGSLCGAPGENCTGTTPRQKVKTHFSRCPKQYKHYCIHGR CRFVVDEQTPSCICEKGYFGARCERVDLFY |
| Supplier Page | Shop |