Name | SUDS3 fusion protein |
---|---|
Supplier | Proteintech Group |
Catalog | Ag22961 |
Category | Protein |
Prices | $199.00 |
Sizes | 50 |
Species Reactivities | Human |
Source | E. coli -derived, PGEX-4T |
Tag/Conjugation | gst |
Purity | 50%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Bioactivity | Not tested. |
Endotoxin | Please contact the lab for more information. |
Gene | SUDS3 |
Sequence | ISSVGANEIWVRKTSDSTKMRIYLGQLQRGLFVIRRRSAA (145-328aa encoded by BC112000 ) |
Supplier Page | Shop |