Human Trefoil Factor 3 full length protein

Name Human Trefoil Factor 3 full length protein
Supplier Abcam
Catalog ab117676
Category Protein
Applications SDS-PAGE
Species Reactivities Human
Nature Recombinant
Source E. coli
Tag/Conjugation His tag N-Terminus
Purity > 95 % by SDS-PAGE. ab117676 is purified by proprietary chromatographic techniques and 0.4µm filtered.
SwissProt/Accession Q07654
Gene TFF3
Residue 22 to 80
Sequence MKHHHHHHASEEYVGLSANQCAVPAKDRVDCGYPHVTPKECNNRGCCFDS RIPGVPWCFKPLQEAECTF
Supplier Page Shop