Active mouse Eotaxin 2 full length protein

• Supplier: Abcam
• Catalog: ab191761
• Category: Protein
• Prices: $192.00
• Sizes: 20 µg
• Applications: FA SDS-PAGE
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: E. coli
• Purity: >95% by SDS-PAGE .
• Bioactivity: Activity was determined by the ability to induce chemotaxis of mouse lymphocytes at concentrations ranging between 10-100 ng/mL
• Endotoxin: < 1.000 Eu/µg
• SwissProt/Accession: O00175
• Gene: CCL24
• Residue: 27 to 119
• Sequence: VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTD PKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV