| Name | Active mouse FGF basic full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab198563 |
| Category | Protein |
| Prices | $300.00, $1,089.00 |
| Sizes | 50 µg, 500 µg |
| Applications | SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Protein Content and Purity (typically = 95%) determined by: Reducing and Non-reducing SDS-PAGE. |
| Bioactivity | The activity is determined by the dose-dependent proliferation of mouse BALB/c 3T3 cells and it is typically less than 1 ng/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P09038 |
| Gene | FGF2 |
| Residue | 10 to 154 |
| Sequence | MPALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPH VKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLES NNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS |
| Supplier Page | Shop |