Active mouse FGF basic full length protein

Name Active mouse FGF basic full length protein
Supplier Abcam
Catalog ab192138
Category Protein
Prices $192.00
Sizes 50 µg
Applications SDS-PAGE FA
Species Reactivities Mouse
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED 50 was determined by the dose-dependent stimulation of thymidine uptake by BaF3 cells expressing FGF receptors is ≤ 0.2 ng/mL, corresponding to a specific activity of ≥ 1.0 x 10 6 units/mg.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P09038
Gene FGF2
Residue 10 to 154
Sequence PALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHV KLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESN NYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Supplier Page Shop