| Name | Active mouse GM-CSF full length protein |
|---|---|
| Supplier | Abcam |
| Catalog | ab198564 |
| Category | Protein |
| Prices | $300.00 |
| Sizes | 20 µg |
| Applications | HPLC SDS-PAGE FA |
| Species Reactivities | Mouse |
| Nature | Recombinant |
| Source | E. coli |
| Purity | >95% by SDS-PAGE . Protein Content and Purity (typically = 95%) determined by: HPLC, Reducing and Non-reducing SDS-PAGE, UV spectroscopy at 280 nm. |
| Bioactivity | The activity is determined by the dose-dependent proliferation of mouse FDCP-1 cell line and it is typically less than 10 pg/mL. |
| Endotoxin | <=1.000 Eu/µg |
| SwissProt/Accession | P04141 |
| Gene | CSF2 |
| Residue | 18 to 141 |
| Sequence | MAPTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKL TCVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTT YADFIDSLKTFLTDIPFECKKPVQK |
| Supplier Page | Shop |