Active mouse GM-CSF full length protein

Name Active mouse GM-CSF full length protein
Supplier Abcam
Catalog ab192129
Category Protein
Prices $192.00
Sizes 20 µg
Applications SDS-PAGE FA
Species Reactivities Mouse
Nature Recombinant
Source E. coli
Purity >95% by SDS-PAGE .
Bioactivity The ED50 as determined by the dose-dependent stimulation of the proliferation of murine FDC-P1 cells is ≤ 0.1 ng/mL, corresponding to a specific activity of ≥ 3.0 x 10^6 units/mg.
Endotoxin < 1.000 Eu/µg
SwissProt/Accession P04141
Gene CSF2
Residue 18 to 141
Sequence APTRSPITVTRPWKHVEAIKEALNLLDDMPVTLNEEVEVVSNEFSFKKLT CVQTRLKIFEQGLRGNFTKLKGALNMTASYYQTYCPPTPETDCETQVTTY ADFIDSLKTFLTDIPFECKKPGQK
Supplier Page Shop