Endoglin Mouse

• Supplier: NeoScientific
• Catalog: CYPS-431
• Category: Protein
• Prices: $65.00, $169.00, $1,287.00
• Sizes: 2 µg, 10 µg, 100 µg
• Species Reactivities: Mouse
• Nature: Recombinant
• Source: Insect Cells.
• Purity: Greater than 95.0% as determined by(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE.
• Bioactivity: Measured by its ability to bind with rhTGF-beta RII/Fc in a functional ELISA. Optimal dilutions should be determined by each laboratory for each application.
• Gene: Eng
• Sequence: MDRGVLPLPITLLFVIYSFVPTTGLAERVGCDLQPVDPTRGEVTFTTSQVSEGCVAQAANAVREVHVLFLDFPGMLSHLELTLQASKQNGTETQEVFLVLVSNKNVFVKFQAPEIPLHLAYDSSLVIFQGQPRVNITVLPSLTSRKQILDWAATKGAITSIAALDDPQSIVLQLGQDPKAPFLCLPEAHKDMGATLEWQPRAQTPVQSCRLEGVSGHKEAYILRILPGSEAGPRTVTVMMELSCTSGDAILILHG
• Description: CD105 Mouse Recombinant extracellular domain produced in baculovirus is a homodimeric, glycosylated, Polypeptide containing 581 amino acids and having a molecular mass of 61 kDa but as a result of glycosylation, migrates at 75-85 kDa under reducing conditions in SDS-PAGE. Based on N-terminal sequenceanalysis, the primary structure of recombinant mature Endoglin starts at Glu 26.The CD105 is fused to a C-terminal His-tag (6xHis) and purified by proprietary chromatographic techniques.