| Name | PLA2G2D Human |
|---|---|
| Supplier | NeoScientific |
| Catalog | ENPS-333 |
| Category | Protein |
| Prices | $65.00, $169.00, $5,070.00 |
| Sizes | 2 µg, 10 µg, 1 mg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia Coli. |
| Purity | Purity of recombinant the human secreted phospholipase A2-IIA is >95%. |
| Gene | PLA2G2D |
| Description | Secreted Phospholipase A2-IID Human Recombinant was produced with N-terminal His-Tag. PLA2G2D His-Tagged Fusion protein is 16.4 kDa containing 125 amino acid residues of the human secreted phospholipase A2-IID and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMGILNLNKMVKQVTGKMPILSYWPYGCHCGLGGRGQPKDATDWCCQTHDCCYDHLKTQGCGIYKYYRYNFSQGNIHCSDKGSWCEQQLCACDKEVAFCLKRNLDTYQKRLRFYWRPHCRGQTPGC. |
| Supplier Page | Shop |