| Name | PLA2G2E Human |
|---|---|
| Supplier | NeoScientific |
| Catalog | ENPS-334 |
| Category | Protein |
| Prices | $65.00, $169.00, $5,070.00 |
| Sizes | 2 µg, 10 µg, 1 mg |
| Species Reactivities | Human |
| Nature | Recombinant |
| Source | Escherichia Coli. |
| Purity | Greater than 95% as determined by SDS PAGE. |
| Gene | PLA2G2E |
| Description | Secreted Phospholipase A2-IIE Human Recombinant manufactured with N-terminal His-Tag. PLA2G2E His-Tagged Fusion Protein is 15.8 kDa protein containing 123 amino acid residues of the human secreted phospholipase A2-IIE and 16 additional amino acid residues – His-Tag (underlined).MRGSHHHHHHGMASHMNLVQFGVMIEKMTGKSALQYNDYGCYCGIGGSHWPVDQTDWCCHAHDCCYGRLEKLGCEPKLEKYLFSVSERGIFCAGRTTCQRLTCECDKRAALCFRRNLGTYNRKYAHYPNKLCTGPTPPC. |
| Supplier Page | Shop |