ME2 Human

• Supplier: NeoScientific
• Catalog: enPS-383
• Category: Protein
• Prices: $65.00, $169.00, $3,120.00
• Sizes: 5 µg, 25 µg, 1 mg
• Species Reactivities: Human
• Nature: Recombinant
• Source: Escherichia Coli.
• Purity: Greater than 95.0% as determined by(a) Analysis by HPLC.(b) Analysis by SDS-PAGE.
• Bioactivity: ME2 activity was assayed spectrophotometrically at 340nm as described in Mandela and Sauer (1975). The standard reaction mixture contained 50mM Tris.HCl, 3mM MnCl2, 5mM malate, 0.12mM NADP+, 2.5mM fumarate, Assay was performed in a Beckman spectrophotometer. The Km value is 1.5
• Gene: ME2
• Sequence: MLHIKEKGKPLMLNPRTNKGMAFTLQERQMLGLQGLLPPKIETQDIQALRFHRNLKKMTSPLEKYIYIMGIQERNEKLFYRILQDDIESLMPIVYTPTVGLACSQYGHIFRRPKGLFISISDRGHVRSIVDNWPENHVKAVVVTDGERILGLGDLGVYGMGIPVGKLCLYTACAGIRPDRCLPVCIDVGTDNIALLKDPFYMGLYQKRDRTQQYDDLIDEFMKAITDRYGRNTLIQFEDFGNHNAFRFLRKYREK
• Description: ME2 Human Recombinant produced in E.coli is a single, non-glycosylated polypeptide chain containing 573 amino acids and having a total molecular mass of 64.4kDa.ME2 is purified by proprietary chromatographic techniques.