GNLY Human

• Supplier: NeoScientific
• Catalog: PRPS-859
• Category: Protein
• Prices: $65.00, $169.00, $5,330.00
• Sizes: 2 µg, 10 µg, 1 mg
• Species Reactivities: Human
• Nature: Recombinant
• Source: Escherichia Coli.
• Purity: Greater than 95.0% as determined by SDS-PAGE.
• Gene: GNLY
• Sequence: MGSSHHHHHHSSGLVPRGSHMMEGLVFSRLSPEYYDLARAHLRDEEKSCPCLAQEGPQGDLLTKTQELGRDYRTCLTIVQKLKKMVDKPTQRSVSNAATRVCRTGRSRWRDVCRNFMRRYQSRVTQGLVAGETAQQICEDLRLCIPSTGPLGSHHHHHH.
• Description: GNLY Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 159 amino acids and fused to a double His Tag (N+C terminus) and having a total molecular mass of 18.1 kDa.The GNLY is purified by proprietary chromatographic techniques.